1.67 Rating by CuteStat

castlewoodhdc.com is 9 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, castlewoodhdc.com is SAFE to browse.

PageSpeed Score
93
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906
Castlewood :: Habilitative Day Centers :: Home

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 4
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 97.74.144.127)

Creekside of Brentwood - Index

- creeksideofbrentwood.org

Creekside of Brentwood - Index

548,824 $ 1,200.00

راه کارگر نیوز

- rahekaregarnews.com

rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

1,387,314 $ 480.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 23 May 2014 06:09:42 GMT
Server: Apache
Accept-Ranges: bytes
Content-Length: 4453
Content-Type: text/html

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: May 19, 2014, 12:00 AM 9 years 11 months 3 weeks ago
Last Modified: May 19, 2014, 12:00 AM 9 years 11 months 3 weeks ago
Expiration Date: May 19, 2015, 12:00 AM 8 years 11 months 3 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns11.domaincontrol.com 97.74.105.6 United States of America United States of America
ns12.domaincontrol.com 173.201.73.6 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
castlewoodhdc.com A 595 IP: 97.74.144.127
castlewoodhdc.com NS 3599 Target: ns12.domaincontrol.com
castlewoodhdc.com NS 3599 Target: ns11.domaincontrol.com
castlewoodhdc.com SOA 3599 MNAME: ns11.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2014051901
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
castlewoodhdc.com MX 3599 Target: smtp.secureserver.net
castlewoodhdc.com MX 3599 Priority: 10
Target: mailstore1.secureserver.net

Full WHOIS Lookup

Domain Name: CASTLEWOODHDC.COM
Registrar URL: http://www.godaddy.com
Registrant Name: Stacey Baird
Registrant Organization: Pixelating Graphix, LLC
Name Server: NS11.DOMAINCONTROL.COM
Name Server: NS12.DOMAINCONTROL.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=CASTLEWOODHDC.COM

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.